PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006616
Common Namedef4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 26367 Da    PI: 9.6571
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006616genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.68.1e-29959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          k+ien++nrqvt+skRrng++KKA+EL vLCda+v+++++sstgkl+e++s
  PGSC0003DMP400006616  9 KKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFIS 59
                          68***********************************************86 PP

2K-box94.61.6e-3171169199
                 K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                           yqk+ g++ +++++e++q++l+kLk+ ++nL++e+R+++Ge+L++L++++L++L +++++slk iR++K++++ +qie+ +kk ++++e
  PGSC0003DMP400006616  71 YQKTIGVDIWTSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNFEQLEELMENVDNSLKLIRERKYKVIGNQIETYRKKVRNVEE 159
                           78888999********************************************************************************* PP

                 K-box  90 enkaLrkkle 99 
                           ++++L  +++
  PGSC0003DMP400006616 160 IHRNLLLEFD 169
                           ****987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.609161IPR002100Transcription factor, MADS-box
CDDcd002654.59E-38280No hitNo description
SuperFamilySSF554552.35E-35395IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-273859IPR002100Transcription factor, MADS-box
PfamPF014863.5E-2082167IPR002487Transcription factor, K-box
PROSITE profilePS5129715.9184174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MARGKIQIKK IENQTNRQVT YSKRRNGLFK KANELTVLCD AKVSIVMISS TGKLHEFISP  60
SITTKQLFDL YQKTIGVDIW TSHYEKMQEQ LRKLKDVNRN LRKEIRQRMG ESLNDLNFEQ  120
LEELMENVDN SLKLIRERKY KVIGNQIETY RKKVRNVEEI HRNLLLEFDA RQEDPYGGLV  180
EQEGDYNSVL GFPTGGHHIL ALGLQPNNNH HHHLHSGGGS DITTFALG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX675080.0X67508.1 S.tuberosum def4 mRNA for deficiens analogue (clone pd4).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275326.11e-167floral homeotic protein PMADS 1-like
SwissprotQ074721e-141MADS1_PETHY; Floral homeotic protein PMADS 1
TrEMBLQ414171e-169Q41417_SOLTU; Deficiens analogue
STRINGPGSC0003DMT4000095101e-168(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23142451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.11e-87MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Garcia-Maroto F,Salamini F,Rohde W
    Molecular cloning and expression patterns of three alleles of the Deficiens-homologous gene St-Deficiens from Solanum tuberosum.
    Plant J., 1993. 4(5): p. 771-80
    [PMID:7903890]